Garder ma session ouverte ?
Expiré dans 
La session est expirée
Votre session a expiré. Pour votre sécurité, VWR vous a déconnecté.
Voulez-vous vous connecter à nouveau?
  • Résultats des produits
  • Catégorie de produit
  • Critères
  • Fournisseur
  • Affiner fournisseurs
    Trier par:

  • Articles en promotion
Votre recherche pour:

Ace+Method+Development+Kits


102 100  les résultats ont été trouvés

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"102100"
  Vue liste Recherche Easy View Vue simple
Trier par:
 
 
 
 


Fournisseur:  Bioss
Description:   Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Considered to have intrinsic transcriptional activity, have some natural ligands such as all-trans retinoic acid (ATRA) and other retinoids which act as inverse agonists repressing the transcriptional activity. Required for normal postnatal development of rod and cone photoreceptor cells. Modulates rod photoreceptors differentiation at least by inducing the transcription factor NRL-mediated pathway. In cone photoreceptor cells, regulates transcription of OPN1SW. Involved in the regulation of the period length and stability of the circadian rhythm. May control cytoarchitectural patterning of neocortical neurons during development. May act in a dose-dependent manner to regulate barrel formation upon innervation of layer IV neurons by thalamocortical axons. May play a role in the suppression of osteoblastic differentiation through the inhibition of RUNX2 transcriptional activity (By similarity)
UOM:  1 * 100 µl

Fournisseur:  Bioss
Description:   Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Considered to have intrinsic transcriptional activity, have some natural ligands such as all-trans retinoic acid (ATRA) and other retinoids which act as inverse agonists repressing the transcriptional activity. Required for normal postnatal development of rod and cone photoreceptor cells. Modulates rod photoreceptors differentiation at least by inducing the transcription factor NRL-mediated pathway. In cone photoreceptor cells, regulates transcription of OPN1SW. Involved in the regulation of the period length and stability of the circadian rhythm. May control cytoarchitectural patterning of neocortical neurons during development. May act in a dose-dependent manner to regulate barrel formation upon innervation of layer IV neurons by thalamocortical axons. May play a role in the suppression of osteoblastic differentiation through the inhibition of RUNX2 transcriptional activity (By similarity)
UOM:  1 * 100 µl
Numéro de catalogue: (ENZOENZ42506)

Fournisseur:  ENZO LIFE SCIENCES
Description:   Cyanine 5-UTP (Enhanced) can replace UTP as a substrate for T7 RNA polymerase in labeling systems that generate labeled probes through in vitro transcription. Probes generated by these methods are suitable for multicolor fluorescence analysis, specifically dual-color expression arrays in conjunction with cyanine 3-UTP.
UOM:  1 * 250 Nmo
New Product
Numéro de catalogue: (NOVUNBP1-82024)

Fournisseur:  Novus Biologicals
Description:   This antibody was developed against Recombinant Protein corresponding to amino acids: GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
UOM:  1 * 0,1 mL
New Product
Numéro de catalogue: (BOSSBS-6817R-A680)

Fournisseur:  Bioss
Description:   Acts as androgen receptor coregulator that increases androgen receptor activity by modulating the receptors interdomain interaction. May play a role in embryonal development and tumor transformation or aspects of tumor progression.
UOM:  1 * 100 µl

Fournisseur:  Bioss
Description:   Acts as androgen receptor coregulator that increases androgen receptor activity by modulating the receptors interdomain interaction. May play a role in embryonal development and tumor transformation or aspects of tumor progression.
UOM:  1 * 100 µl
Numéro de catalogue: (BOSSBS-1275R-A350)

Fournisseur:  Bioss
Description:   Transcriptional repressor that plays an important role in the specification and differentiation of lung epithelium. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Essential transcriptional regulator of B-cell development.
UOM:  1 * 100 µl
Numéro de catalogue: (BOSSBS-1275R-A488)

Fournisseur:  Bioss
Description:   Transcriptional repressor that plays an important role in the specification and differentiation of lung epithelium. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Essential transcriptional regulator of B-cell development.
UOM:  1 * 100 µl
Numéro de catalogue: (40-1276-U100)

Fournisseur:  Tonbo Biosciences
Description:   The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils.
UOM:  1 * 1 EA
Numéro de catalogue: (BOSSBS-9461R-A488)

Fournisseur:  Bioss
Description:   The LIN-12/Notch family of transmembrane receptors plays a central role in development by regulating cell fate and establishing boundaries of gene expression. Notch signaling activates the Hairy/Enhancer of split (HES) genes, which encode basic helix-loop-helix (bHLH) transcriptional repressors that are critical for directing embryonic patterning and development. The Hairy-related transcription factors (HRTs) comprise a subclass of bHLH proteins that exhibit structural similarity with the HES proteins and include HRT1, HRT2 and HRT3. The HRT family (also designated Hesr, Hey, CHF and Gridlock) contain a bHLH domain, an Orange domain and a novel YRPW domain, which is absent in HRT3. The Hairy-related genes map to human chromosomes 8q21, 6q21 and 1p34.3 for HRT1, HRT2 and HRT3, respectively, and are downstream targets for Notch signaling. HRT1 is expressed in the somitic mesoderm, central nervous system, kidney, heart, nasal epithelium and limb buds in murine embryos as well as in adult tissues. It has altered expression in many breast, lung and kidney tumors. Like HRT1, HRT2 and HRT3 are also expressed in developing somites, heart and nervous system.
UOM:  1 * 100 µl
Numéro de catalogue: (BOSSBS-3714R-CY3)

Fournisseur:  Bioss
Description:   This gene encodes a member of the p53 family of transcription factors. An animal model, p63 -/- mice, has been useful in defining the role this protein plays in the development and maintenance of stratified epithelial tissues. p63 -/- mice have several developmental defects which include the lack of limbs and other tissues, such as teeth and mammary glands, which develop as a result of interactions between mesenchyme and epithelium. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. Both alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different proteins. Many transcripts encoding different proteins have been reported but the biological validity and the full-length nature of these variants have not been determined. [provided by RefSeq, Jul 2008].
UOM:  1 * 100 µl
Numéro de catalogue: (BOSSBS-7112R-CY3)

Fournisseur:  Bioss
Description:   G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis (By similarity). Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.
UOM:  1 * 100 µl
Numéro de catalogue: (BOSSBS-11834R-CY3)

Fournisseur:  Bioss
Description:   Dyrk (for dual specificity tyrosine phosphorylation regulated kinase) is the homolog of the Drosophila mnb (minibrain) gene which is required for neurogenesis. Dyrk is a dual-specificity tyrosine kinase and serine/threonine kinase, which is itself regulated by tyrosine phosphorylation. Several mammalian Dyrk related proteins have been identified and are thought to compose a family of dual specificity protein kinases. Dyrk family members, including Dyrk1A (dual specificity tyrosine-phosphorylation-regulated kinase 1A), Dyrk1B, Dyrk1C, Dyrk2, Dyrk3, Dyrk4A and Dyrk4B, are thought to be involved in diverse cellular functions. Localized to the nucleus and highly expressed in testis, muscle and the developing nervous system, Dyrk1A, also known as MNB or MNBH, functions to phosphorylate serine, threonine and tyrosine residues on various substrates involved in signaling pathways that regulate cell proliferation. Dyrk1A is a candidate gene for learning defects that are involved in Downs syndrome (DS), suggesting a possible role for Dyrk1A in the development of DS. Four isoforms of Dyrk1A exist due to alternative splicing events.
UOM:  1 * 100 µl
Fournisseur:  Thermo Scientific
Description:   4-(2-Pyridylazo)résorcinol ACS
Numéro de catalogue: (BOSSBS-7836R-CY5.5)

Fournisseur:  Bioss
Description:   Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.
UOM:  1 * 100 µl
Numéro de catalogue: (BOSSBS-6133R-A750)

Fournisseur:  Bioss
Description:   Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
UOM:  1 * 100 µl
Appel de prix
Le stock de cet article est limité mais peut être disponible dans un entrepôt proche de vous. Merci de vous assurer que vous êtes connecté sur le site afin que le stock disponible soit affiché. Si l'call est toujours affiché et vous avez besoin d'aide, s'il vous plaît appelez-nous au 016 385 011
Le stock de cet article est limité mais peut être disponible dans un entrepôt proche de vous. Merci de vous assurer que vous êtes connecté sur le site afin que le stock disponible soit affiché. Si l'call est toujours affiché et vous avez besoin d'aide, s'il vous plaît appelez-nous au 016 385 011
Ces articles ne peuvent être ajoutés au Panier. Veuillez contacter votre service client ou envoyer un e-mail à vwr.be@vwr.com
Une documentation supplémentaire peut être nécessaire pour l'achat de cet article. Un représentant de VWR vous contactera si nécessaire.
Ce produit a été bloqué par votre organisation. Contacter votre service d'achat pour plus d'informations.
Le produit original n'est plus disponible. Le remplacement représenté est disponible
Les produits marqués de ce symbole ne seront bientôt plus disponibles - vente jusqu'à épuisement de stock. Des alternatives peuvent être disponibles en recherchant le code article VWR indiqué ci-dessus. Si vous avez besoin d'une assistance supplémentaire, veuillez contacter notre Service Clientèle au 016 385 011.
2 945 - 2 960  de 102 100